FOXO4

$239.00

Also known as: FOXO4-DRI, proxofim, senolytic peptide, anti-senescence

Amount

Clear

SKU: foxo4 Category: Research Peptides

✓ ≥99% PURITY✓ THIRD-PARTY TESTED✓ COA AVAILABLE

Chemical Specifications

Field	Value
Compound	FOXO4-DRI (proxofim)
CAS Number	2306193-51-3
Molecular Formula	C₁₉₄H₃₀₄N₆₃O₆₁
Molecular Weight	4441.9 g/mol
Purity	≥99%
Sequence	LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPKLGQIGRSKTP (D-retro-inverso)
Aliases	FOXO4-DRI, Proxofim, senolytic peptide, anti-senescence

Storage

Lyophilized: shelf-stable at room temperature during transit. Store at −20 °C for long-term.
Reconstituted: 2–8 °C, use within 30 days.

Quality

Tested by verified third-party U.S. laboratories. Per-lot Certificate of Analysis delivered via the QR code printed on each vial.

Format

Lyophilized powder in a sealed glass vial. Reconstitute with bacteriostatic water before use in research protocols.

Research Context

FOXO4-DRI is a D-retro-inverso peptide designed to disrupt the FOXO4–p53 interaction inside senescent cells. In the published literature it has been studied as a senolytic tool compound — a research reagent used to selectively eliminate senescent cells while sparing healthy ones. Sold strictly for in vitro or laboratory research use only.

Amount	10mg

Reviews

There are no reviews yet.

Be the first to review “FOXO4”

What is FOXO4?

FOXO4 is a research peptide sold by Luminos Peptides for laboratory research use only. Each vial ships lyophilized (freeze-dried) and requires reconstitution with bacteriostatic water before use in a research protocol. All Luminos peptides are analyzed by an independent third-party laboratory for identity and purity.

What is the purity specification?

Every Luminos vial ships at 99% or higher HPLC purity, verified by an independent third-party laboratory. Purity, mass-spectrometry identity, endotoxin, and water content are all documented on a lot-specific Certificate of Analysis.

Do you provide a lot-specific Certificate of Analysis?

Yes. Every vial ships with a QR code on the label that links directly to the Freedom Analytics COA for that specific lot number — not a generic company COA. HPLC purity, mass spectrometry identity, endotoxin, and water content are all documented per lot.

How should I store this peptide?

Lyophilized vials are shelf-stable at room temperature during transit and should be stored at minus 20 degrees Celsius for long-term storage. Once reconstituted with bacteriostatic water, store the vial at 2 to 8 degrees Celsius (refrigerator) and use within 30 days for best stability.

Is this for research use only?

Yes. All Luminos Peptides products are sold strictly for in vitro laboratory research and are not intended, labeled, packaged, or advertised for human or veterinary consumption or use.

Age Verification Required